RepliTope™ Human (HLA classI Ig-like C1 type domain)
Product Code: RT-C1
Peptide microarray displaying 19 peptides derived from a peptide scan (15mers with 11 aa overlap) through HLA class I histocompatibility antigen, A-36 alpha chain (Swiss-Prot ID: P30455, aa 208-295) of Homo sapiens (Human).Amount: 1 peptide microarray (each peptide is deposited 3x per subarray,4 subarrays per slide) + dummy slide and spacers (needed for incubation)Purity: Free of truncated sequences Delivery Format: Peptides immobilized onto glass slide (3 x 1 inches; 75 by 25 mm)Application(s): Immune monitoring, Humoral immune response, Seromarker discovery, Antibody epitope discovery, Binding experimentsIndication(s)/Topic(s): ControlDelivery Time: 10-12 days
RepliTope™ Peptide Microarrays JPT Peptide Technologies applies its unique peptide microarray platform to generate peptide microarrays on glass slides for biomarker discovery, immunomonitoring and detection and validation of protein interactions.Peptides are immobilized on glass slides via a flexible linker by chemoselective coupling. The covalently attached peptides are displayed infour copies on each slide. In addition, multiple identical copies of each microarray are produced. Incubation can be performed manually or automated using only minimal amounts of your sample. Read-out via fluorescence results in low background and high sensitivity.
Benefits of JPTs RepliTope™ Peptide Microarrays - Get hundreds of identical microarray copies - Peptides are free of truncated sequences - Small amounts of your precious samples are needed for incubation - Applicable to a variety of biological samples (e.g. serum, plasma, antibody)- Low background on glass surface - Read-out via fluorescence
RepliTope™ Human (HLA classI Ig-like C1 type domain)
Selected References for JPTs Peptide Microarrays\"Structure of GPN-loop GTPase Npa3 and Implications for RNA Polymerase II Assembly\" Niesser t al., Mol Cell Biol. (2015) - PMID: 26711263 \"Protective Efficacy of Adenovirus-protein Vaccines Against SIV Challenges in Rhesus Monkeys\" Barouch et al., Science (2015) - PMID: 26138104\"Identification and Characterization of Common B Cell Epitope in Bovine Leukemia Virus via High-throughput Peptide Screening System in Infected Cattle\" Bai et al., Retrovirology (2015) - PMID: 26715158\"High-Throughput Microarray Incubations Using Multi-Well Chambers\" Zerweck et al., Methods Mol Biol. (2015) - PMID: 26490464\"Peptide Microarrays for Coverage of Sequence Diversity in Monitoring the B cell Immune Response (TECH2P.911)\" Castro, et al., The Journal of Immunology (2015) - PMID: n.a.\"Antibodies to Influenza Nucleoprotein Cross-react with Human Hypocretin Receptor 2\" Ahmed et al., Science Translational Medicine (2015) - PMID: 26136476\"Serum Reactome Induced by Bordetella Pertussis Infection and Pertussis Vaccines: Qualitative Differences in Serum Antibody Recognition Patterns Revealed by Peptide Microarray Analysis\" Valentini et al., BMC Immunol. (2015) - PMID: 26129684
Application Notes\"A Modular Approach for Epitope Discovery and High-Resolution Profiling of Humoral Immune Responses\" Pawlowski et al. (2013) Full text\"Multiple Sclerosis and Epstein Barr Virus Infection. An Epitope Mapping Study\" Reimer et al. (2014) Full text\"The Challenge of Antigen Sequence Diversity:Solutions with ULTRA Peptide Libraries\" Pawlowski et al. (2015) Full text\"Rapid Mimotope Optimization for Pharmacokinetic Analysis of the Novel Therapeutic antibody IMAB362\" Daneschar et al. (2014) Full text
Testimonials for JPTs Peptide Microarrays \"Over the past five years my research team has been active in the development of species-specific peptide arrays. Our ability to advance this technology into new research areas has been dependent on working with the highest quality of arrays. In this regard, JPTs commitment to excellence has been a critical foundation for the success of our research program. I have been consistently impressed with their customer service, technical expertise and professionalism. When it comes to peptide work there are no other options for our group, JPT is the best.\"Scott Napper, PhD, Vaccine and Infectious Disease Organization (VIDO), University of Saskatchewan, Canada\"The RV 144 HIV trial is considered as one of first successful HIV vaccine trials. It has become clear that the V2 loop of gp120 is an important site for immunogenicity and protection from HIV infection. The use of JPTs PepStar™ microarray technology has been very useful for the correlation of the clincial outcome with humoral immune responses. As have the cyclic peptides been from JPT to validate these findings!.\"Jeff Currier, PhD, Walter Reed Army Institute, Rockville, Maryland, USA \"We study modulation of dopaminergic neurotransmisson by TAAR1 and D2R. The functional interaction of the two receptors in the brain supports TAAR1 as a target for the treatment of psychiatric disorders such as schizophrenia or bipolar disorder. To map the epitopes of our newly generated specific anti-rat TAAR1 antibodies we used JPTs PepStarTM peptide microarrays. The peptide microarrays greatly contributed to our successful and recently published study. We were very satisified with the exceptional product and service delivered by JPT Peptide Technologies as well as their scientific Customer Support which was always at our disposal.\" Stefan Obermüller, F.Hoffmann - La Roche Ltd., Roche Pharma Research and Early Development, Basel, Switzerland
RepliTope™ Human (HLA classI Ig-like C1 type domain)
Technical Data:Application | Antibody epitope discoveryCancer biomarker researchImmune monitoringCancer biomarker research |
Protein Name | HLA class I histocompatibility antigen, A-36 alpha chain |
Organism | Homo sapiens (Human) |
Indication / Topic | Control |
Number of peptides | 19 |
Amount | 1 peptide microarray (each peptide is deposited 3x per subarray, 4 subarrays per slide) + dummy slide and spacers (needed for manual incubation) |
Specifications | Peptide scan (15mers with 11 aa overlap) |
Documentation | CD with Protocol, Datasheet, gal-file and gal-viewer |
Swiss-Prot ID | P30455 |
NCBI | |
Sequence | PKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLT |
Protein Length (aa) | 87 |
本文链接: http://ig.immuno-online.com/view-1555494692.html